PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.08G329300.1.p
Common NameGLYMA_08G329300, LOC100813169
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 192aa    MW: 20352.7 Da    PI: 6.9467
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.08G329300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1841.2e-5723118297
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyveplk yl+++r
  Glyma.08G329300.1.p  23 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVEPLKGYLQRFR 112
                          89**************************************************************************************** PP

                NF-YB  92 elegek 97 
                          e+egek
  Glyma.08G329300.1.p 113 EMEGEK 118
                          ****97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.5E-5518129IPR009072Histone-fold
SuperFamilySSF471131.22E-4025132IPR009072Histone-fold
PfamPF008085.3E-282892IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.8E-205674No hitNo description
PROSITE patternPS0068505975IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.8E-207593No hitNo description
PRINTSPR006154.8E-2094112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MADSDNDSGG AHNGGKGSEM SPREQDRFLP IANVSRIMKK ALPANAKISK DAKETVQECV  60
SEFISFITGE ASDKCQREKR KTINGDDLLW AMTTLGFEDY VEPLKGYLQR FREMEGEKTV  120
AARDKDAPPL TNATNSAYES ANYAAAAAVP GGIMMHQGHV YGSAGFHQVA GGAIKGGPAY  180
PGPGSNAGRP R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B3e-4820113194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4820113194NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.290900.0cotyledon
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006586138.11e-142PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233105e-74NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLI1KYJ41e-142I1KYJ4_SOYBN; Uncharacterized protein
STRINGGLYMA08G44140.11e-141(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.18e-75nuclear factor Y, subunit B3